Pepper Sticks
$14.99
Bold and savory pepper sticks handmade by Stittsworth Meats. Premium cuts of meat seasoned with cracked black pepper and a custom spice blend, then slow-smoked to perfection. High-protein, hearty snack with a satisfying spicy kick. Great for charcuterie, road trips, or anytime hunger strikes.
Options
Default Title — $14.99
bemidji-mngrillinghigh-proteinjerkymeat-stickspeppersnackstittsworth-meats
Handcrafted in Bemidji, MN • Ships fresh • 120-day shelf life